TNFAIP3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A2127
Additional Names:: A20|AIFBL1|AISBL|OTUD7C|TNFA1P2|TNFAIP3
Application:: ELISA, WB, IHC-P
Molecular Weight:: 90 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQH
Uniprot:: P21580
Synonyms:: A20;AISBL;OTU domain-containing protein 7C;OTUD7C;putative DNA-binding protein A20;TNFA1P2;tumor necrosis factor alpha-induced protein 3;tumor necrosis factor inducible protein A20;tumor necrosis factor, alpha induced protein 3;zinc finger protein A20
Extra Details:: This gene was identified as a gene whose expression is rapidly induced by the tumor necrosis factor (TNF). The protein encoded by this gene is a zinc finger protein and ubiqitin-editing enzyme, and has been shown to inhibit NF-kappa B activation as well as TNF-mediated apoptosis. The encoded protein, which has both ubiquitin ligase and deubiquitinase activities, is involved in the cytokine-mediated immune and inflammatory responses. Several transcript variants encoding the same protein have been found for this gene.