A21237
CLCN1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A21237
- Additional Names:
- CLC1|CLCN1
- Application:
- ELISA, WB
- Molecular Weight:
- 109 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NTTSTRKSTGAPPSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESPGLEEELADILQGPSLRSTDEEDEDELIL
- Uniprot:
- P35523
- Synonyms:
- chloride channel 1, skeletal muscle;chloride channel protein 1;chloride channel protein, skeletal muscle;chloride channel, voltage-sensitive 1;clC-1;CLC1
- Extra Details:
- The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encoded by this gene regulates the electric excitability of the skeletal muscle membrane. Mutations in this gene cause two forms of inherited human muscle disorders: recessive generalized myotonia congenita (Becker) and dominant myotonia (Thomsen). Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice