PLZF Rabbit monoclonal antibody

Size

POA

SKU:: A21185
Additional Names:: PLZF|ZNF145
Application:: ELISA, WB, IF, IP
Molecular Weight:: 80kDa/80kd
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
Uniprot:: Q05516
Synonyms:: PLZF;promyelocytic leukaemia zinc finger;Promyelocytic leukemia zinc finger protein;zinc finger and BTB domain-containing protein 16;Zinc finger protein 145;zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia);zinc finger protein PLZF;ZNF145
Extra Details:: This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.