AER61 Rabbit monoclonal antibody

Size

POA

SKU:: A21166
Additional Names:: AER61|AOS4|C3orf64|EOGT1
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MLMLFVFGVLLHEVSLSGQNEAPPNTHSIPGEPLYNYASIRLPEEHIPFFLHNNRHIATVCRKDSLCPYKKHLEKLKYCWGYEKSCKPEFRFGYPVCSYVDMGWTDTLESAEDIFWKQADFGYARERLEEMHVLCQPKETSDSSLVCSRY
Uniprot:: Q5NDL2
Synonyms:: AER61;AER61 glycosyltransferase;AOS4;C3orf64;EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase;EGF domain-specific O-linked N-acetylglucosamine transferase;EGF-O-GlcNAc transferase;EOGT1;extracellular O-linked N-acetylglucosamine transferase
Extra Details:: This gene encodes an enzyme that acts in the lumen of the endoplasmic reticulum to catalyze the transfer of N-acetylglucosamine to serine or threonine residues of extracellular-targeted proteins. This enzyme modifies proteins containing eukaryotic growth factor (EGF)-like domains, including the Notch receptor, thereby regulating developmental signalling. Mutations in this gene have been observed in individuals with Adams-Oliver syndrome 4. Alternative splicing results in multiple transcript variants.