A21161
ULBP1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A21161
- Additional Names:
- N2DL-1|NKG2DL1|RAET1I|ULBP1
- Application:
- ELISA, WB
- Molecular Weight:
- 36 kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAAASPAFLLCLPLLHLLSGWSRAGWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDF
- Uniprot:
- Q9BZM6
- Synonyms:
- alcan-beta;N2DL-1;NKG2D ligand 1;NKG2DL1;RAET1I;retinoic acid early transcript 1I;UL16-binding protein 1
- Extra Details:
- The protein encoded by this gene is a ligand of natural killer group 2, member D (NKG2D), an immune system-activating receptor on NK cells and T-cells. Binding of the encoded ligand to NKG2D leads to activation of several signal transduction pathways, including those of JAK2, STAT5, ERK and PI3K kinase/Akt. Also, in cytomegalovirus-infected cells, this ligand binds the UL16 glycoprotein and is prevented from activating the immune system. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice