A21149
CLIC4 Rabbit monoclonal antibody

Size
POA
- SKU:
- A21149
- Additional Names:
- CLIC4|CLIC4L|H1|huH1|MTCLIC|p64H1
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLC
- Uniprot:
- Q9Y696
- Synonyms:
- chloride intracellular channel 4 like;chloride intracellular channel protein 4;CLIC4L;epididymis secretory sperm binding protein;H1;huH1;intracellular chloride ion channel protein p64H1;MTCLIC;p64H1
- Extra Details:
- Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).
- Shipping Conditions:
- Blue Ice

