A21138
NUP155 Rabbit monoclonal antibody
Size
POA
- SKU:
- A21138
- Additional Names:
- ATFB15|N155|NUP155
- Application:
- ELISA, WB
- Molecular Weight:
- 155kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLAD
- Uniprot:
- O75694
- Synonyms:
- 155 kDa nucleoporin;ATFB15;N155;nuclear pore complex protein Nup155;nucleoporin 155kD;nucleoporin 155kDa;Nucleoporin Nup155
- Extra Details:
- Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the fusion of NE vesicles and formation of the double membrane NE. The protein may also be involved in cardiac physiology and may be associated with the pathogenesis of atrial fibrillation. Alternative splicing results in multiple transcript variants of this gene. A pseudogene associated with this gene is located on chromosome 6.
- Shipping Conditions:
- Blue Ice