A21128
MLD Rabbit monoclonal antibody
Size
POA
- SKU:
- A21128
- Additional Names:
- DEGS|DEGS-1|Des-1|DES1|FADS7|HLD18|MIG15|MLD
- Application:
- ELISA, WB
- Molecular Weight:
- 34kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNC
- Uniprot:
- O15121
- Synonyms:
- cell migration-inducing gene 15 protein;Degenerative spermatocyte homolog 1;degenerative spermatocyte homolog 1, lipid desaturase;degenerative spermatocyte homolog, lipid desaturase;DEGS;DEGS-1;Des-1;DES1;dihydroceramide desaturase 1;FADS7;HLD18;membrane fatty acid (lipid) desaturase;membrane lipid desaturase;MIG15;migration-inducing gene 15 protein;MLD;sphingolipid delta 4 desaturase;sphingolipid delta(4)-desaturase 1;sphingolipid delta(4)-desaturase DES1
- Extra Details:
- This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.
- Shipping Conditions:
- Blue Ice