A21076
SFT Rabbit monoclonal antibody
Size
POA
- SKU:
- A21076
- Additional Names:
- E2(17)KB1|SFT|UBC4/5|UBCH5|UBCH5A
- Application:
- ELISA, IHC-P
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- FFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
- Uniprot:
- P51668
- Synonyms:
- (E3-independent) E2 ubiquitin-conjugating enzyme D1;E2 ubiquitin-conjugating enzyme D1;E2(17)KB1;SFT;stimulator of Fe transport;UBC4/5;UBC4/5 homolog;UBCH5;UBCH5A;ubiquitin carrier protein D1;ubiquitin conjugating enzyme E2D 1;ubiquitin-conjugating enzyme E2 D1;ubiquitin-conjugating enzyme E2-17 kDa 1;ubiquitin-conjugating enzyme E2(17)KB 1;ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast);ubiquitin-protein ligase D1
- Extra Details:
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice