A21073
CD32A + CD32B + CD32C Rabbit monoclonal antibody

Size
POA
- SKU:
- A21073
- Additional Names:
- CD32|CD32A|CD32A + CD32B + CD32C|CDw32|FCG2|FcgammaRIIa|FcGR|FCGR2|FCGR2A1|IGFR2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 25-50kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSG
- Uniprot:
- P12318, P31994, P31995
- Synonyms:
- CD32;CD32A;CD32B;CD32C;CDw32;Fc fragment of IgG, low affinity II, receptor for (CD32);Fc fragment of IgG, low affinity IIa, receptor (CD32);Fc fragment of IgG, low affinity IIb, receptor (CD32);Fc fragment of IgG, low affinity IIb, receptor for (CD32);Fc fragment of IgG, low affinity IIc, receptor for (CD32);Fc gamma receptor IIb;Fc gamma receptor IIC;Fc gamma receptor RIIa3;Fc gamma RIIb;Fc-gamma RII-a;fc-gamma RII-b;Fc-gamma RII-c;fc-gamma-RIIa;fc-gamma-RIIb;Fc-gamma-RIIc;FCG2;FcGR;FCGR2;FCGR2A1;FCGR2C;fcRII-a;fcRII-b;FcRII-c;FCRIIC;IGFR2;igG Fc receptor II-a;igG Fc receptor II-b;IgG Fc receptor II-c;Immunoglobulin G Fc receptor II;immunoglobulin G Fc receptor II-c;low affinity immunoglobulin gamma Fc region receptor II-a;low affinity immunoglobulin gamma Fc region receptor II-b;Low affinity immunoglobulin gamma Fc region receptor II-c
- Extra Details:
- This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice





