A2107
POLR2A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2107
- Additional Names:
- hRPB220|hsRPB1|NEDHIB|POLR2|POLR2A|POLRA|RPB1|RPBh1|RpIILS|RPO2|RPOL2
- Application:
- ELISA, WB, IF, ICC, IP
- Molecular Weight:
- 210-250 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MHGGGPPSGDSACPLRTIKRVQFGVLSPDELKRMSVTEGGIKYPETTEGGRPKLGGLMDPRQGVIERTGRCQTCAGNMTECPGHFGHIELAKPVFHVGFLVKTMKVLRCVCFFCSKLLVDSNNPKIKDILAKSKGQPKKRLTHVYDLCKGKNICEGGEEMDNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQEKKILLSPERVHEIFKRISDEECFVLGMEPRYARPEWMIVTVLPVPPLSV
- Uniprot:
- P24928
- Synonyms:
- DNA-directed RNA polymerase II largest subunit, RNA polymerase II 220 kd subunit;DNA-directed RNA polymerase II subunit A;DNA-directed RNA polymerase II subunit RPB1;DNA-directed RNA polymerase III largest subunit;hRPB220;hsRPB1;NEDHIB;POLR2;POLRA;polymerase (RNA) II (DNA directed) polypeptide A, 220kDa;polymerase (RNA) II subunit A;RNA polymerase II subunit B1;RNA-directed RNA polymerase II subunit RPB1;RPB1;RPBh1;RpIILS;RPO2;RPOL2
- Extra Details:
- This gene encodes the largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a carboxy terminal domain composed of heptapeptide repeats that are essential for polymerase activity. These repeats contain serine and threonine residues that are phosphorylated in actively transcribing RNA polymerase. In addition, this subunit, in combination with several other polymerase subunits, forms the DNA binding domain of the polymerase, a groove in which the DNA template is transcribed into RNA.
- Shipping Conditions:
- Blue Ice


_WB_01.jpg)
