KATNB1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A21041
Additional Names:: KAT|KATNB1|LIS6
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 72kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SEPFPAPPEDDAATAKEAAKPSPAMDVQFPVPNLEVLPRPPVVASTPAPKAEPAIIPATRNEPIGLKASDFLPAVKIPQQAELVDEDAMSQIRKGHDTMCV
Uniprot:: Q9BVA0
Synonyms:: KAT;katanin (80 kDa);katanin p80 (WD repeat containing) subunit B 1;katanin p80 (WD40-containing) subunit B 1;katanin p80 subunit B1;katanin p80 WD40 repeat-containing subunit B1;katanin p80 WD40-containing subunit B1;LIS6;p80 katanin
Extra Details:: Microtubules, polymers of alpha and beta tubulin subunits, form the mitotic spindle of a dividing cell and help to organize membranous organelles during interphase. Katanin is a heterodimer that consists of a 60 kDa ATPase (p60 subunit A 1) and an 80 kDa accessory protein (p80 subunit B 1). The p60 subunit acts to sever and disassemble microtubules, while the p80 subunit targets the enzyme to the centrosome. Katanin is a member of the AAA family of ATPases.