A21040
SDHC Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A21040
- Additional Names:
- CYB560|CYBL|PGL3|QPS1|SDH3|SDHC
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYL
- Uniprot:
- Q99643
- Synonyms:
- CYB560;CYBL;cytochrome B large subunit of complex II;Integral membrane protein CII-3;integral membrane protein CII-3b;large subunit of cytochrome b;PGL3;QPs-1;QPS1;SDH3;succinate dehydrgenase cytochrome b;succinate dehydrogenase 3, integral membrane subunit;Succinate dehydrogenase complex subunit C;succinate dehydrogenase complex subunit C integral membrane protein 15kDa;succinate dehydrogenase complex, subunit C, integral membrane protein, 15kD;succinate dehydrogenase cytochrome b560 subunit, mitochondrial;succinate-ubiquinone oxidoreductase cytochrome B large subunit
- Extra Details:
- This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described.
- Shipping Conditions:
- Blue Ice








