PDGFR alpha Rabbit polyclonal antibody

Size

£152.00

SKU:: A2103
Additional Names:: CD140A|PDGFR alpha|PDGFR-2|PDGFR2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 150-190kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTF
Uniprot:: P16234
Synonyms:: Alpha platelet-derived growth factor receptor;alpha-type platelet-derived growth factor receptor;CD140 antigen-like family member A;CD140A;CD140a antigen;PDGF-R-alpha;PDGFR-2;PDGFR2;Platelet-derived growth factor alpha receptor;platelet-derived growth factor receptor 2;platelet-derived growth factor receptor alpha;platelet-derived growth factor receptor, alpha polypeptide
Extra Details:: This gene encodes a cell surface tyrosine kinase receptor for members of the platelet-derived growth factor family. These growth factors are mitogens for cells of mesenchymal origin. The identity of the growth factor bound to a receptor monomer determines whether the functional receptor is a homodimer or a heterodimer, composed of both platelet-derived growth factor receptor alpha and beta polypeptides. Studies suggest that this gene plays a role in organ development, wound healing, and tumor progression. Mutations in this gene have been associated with idiopathic hypereosinophilic syndrome, somatic and familial gastrointestinal stromal tumors, and a variety of other cancers.

Shipping Conditions:: Blue Ice