IRE1 Rabbit monoclonal antibody

Size

POA

SKU:: A21021
Additional Names:: hIRE1p|IRE1|IRE1a|IRE1P
Application:: ELISA, WB
Molecular Weight:: 130kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDVKFDPGLKSKNKLNYLRNYWLLIGHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVDQTSENAPTTVSRDVEEKPAHAPARPEA
Uniprot:: O75460
Synonyms:: Endoplasmic reticulum-to-nucleus signaling 1;ER to nucleus signalling 1;hIRE1p;inositol-requiring 1;inositol-requiring enzyme 1;inositol-requiring protein 1;IRE1;ire1-alpha;IRE1a;IRE1P;protein kinase/endoribonuclease;serine/threonine-protein kinase/endoribonuclease IRE1
Extra Details:: This gene encodes the transmembrane protein kinase inositol-requiring enzyme 1. The encoded protein contains two functional catalytic domains, a serine/threonine-protein kinase domain and an endoribonuclease domain. This protein functions as a sensor of unfolded proteins in the endoplasmic reticulum (ER) and triggers an intracellular signaling pathway termed the unfolded protein response (UPR). The UPR is an ER stress response that is conserved from yeast to mammals and activates genes involved in degrading misfolded proteins, regulating protein synthesis and activating molecular chaperones. This protein specifically mediates the splicing and activation of the stress response transcription factor X-box binding protein 1.

Shipping Conditions:: Blue Ice