A2102
PDE1B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A2102
- Additional Names:
- HEL-S-79p|PDE1B|PDE1B1|PDES1B
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 59kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD
- Uniprot:
- Q01064
- Synonyms:
- 63 kDa Cam-PDE;calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B;calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase;calmodulin-stimulated phosphodiesterase PDE1B1;cam-PDE 1B;epididymis secretory sperm binding protein Li 79p;HEL-S-79p;PDE1B1;PDES1B;phosphodiesterase 1B, calmodulin-dependent;presumed 63kDa form of the type 1 cyclic nucleotide phosphodiesterase family known as PDE1B
- Extra Details:
- The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice