A20991
PKM2-specific Rabbit monoclonal antibody

Size
POA
- SKU:
- A20991
- Additional Names:
- CTHBP|HEL-S-30|OIP3|p58|PK3|PKM2|PKM2-specific|TCB|THBP1
- Application:
- ELISA, WB, IF, ICC, IP
- Molecular Weight:
- 58 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE
- Uniprot:
- P14618
- Synonyms:
- CTHBP;cytosolic thyroid hormone-binding protein;epididymis secretory protein Li 30;HEL-S-30;OIP3;OPA-interacting protein 3;p58;PK, muscle type;PK3;PKM2;pyruvate kinase 2/3;pyruvate kinase isozymes M1/M2;pyruvate kinase muscle isozyme;pyruvate kinase PKM;pyruvate kinase, muscle;TCB;THBP1;thyroid hormone-binding protein 1;thyroid hormone-binding protein, cytosolic;tumor M2-PK
- Extra Details:
- This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Several alternatively spliced transcript variants encoding a few distinct isoforms have been reported.
- Shipping Conditions:
- Blue Ice







