A20981
PTPRR Rabbit monoclonal antibody
Size
POA
- SKU:
- A20981
- Additional Names:
- EC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQ|PTPRR
- Application:
- ELISA, WB
- Molecular Weight:
- 74kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMD
- Uniprot:
- Q15256
- Synonyms:
- Ch-1 PTPase;ch-1PTPase;EC-PTP;NC-PTPCOM1;PCPTP1;protein tyrosine phosphatase Cr1PTPase;protein-tyrosine phosphatase NC-PTPCOM1;protein-tyrosine phosphatase PCPTP1;PTP-SL;PTPBR7;PTPRQ;R-PTP-R;receptor-type tyrosine-protein phosphatase R
- Extra Details:
- The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domain, and thus represents a receptor-type PTP. Silencing of this gene has been associated with colorectal cancer. Multiple transcript variants encoding different isoforms have been found for this gene. This gene shares a symbol (PTPRQ) with another gene, protein tyrosine phosphatase, receptor type, Q (GeneID 374462), which is also located on chromosome 12.
- Shipping Conditions:
- Blue Ice