A20978
GNE Rabbit monoclonal antibody
Size
POA
- SKU:
- A20978
- Additional Names:
- DMRV|GLCNE|GNE|IBM2|NM|Uae1
- Application:
- ELISA, WB
- Molecular Weight:
- 75 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRRIY
- Uniprot:
- Q9Y223
- Synonyms:
- bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase;DMRV;GLCNE;IBM2;N-acylmannosamine kinase;NM;Uae1;UDP-GlcNAc-2-epimerase/ManAc kinase;UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase
- Extra Details:
- The protein encoded by this gene is a bifunctional enzyme that initiates and regulates the biosynthesis of N-acetylneuraminic acid (NeuAc), a precursor of sialic acids. It is a rate-limiting enzyme in the sialic acid biosynthetic pathway. Sialic acid modification of cell surface molecules is crucial for their function in many biologic processes, including cell adhesion and signal transduction. Differential sialylation of cell surface molecules is also implicated in the tumorigenicity and metastatic behavior of malignant cells. Mutations in this gene are associated with sialuria, autosomal recessive inclusion body myopathy, and Nonaka myopathy. Alternative splicing of this gene results in transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice