A20964
MST4 Rabbit monoclonal antibody
Size
POA
- SKU:
- A20964
- Additional Names:
- MASK|MST4
- Application:
- ELISA, WB
- Molecular Weight:
- 52kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
- Uniprot:
- Q9P289
- Synonyms:
- mammalian Ste20-like protein kinase 4;mammalian sterile 20-like 4;MASK;Mst3 and SOK1-related kinase;MST4;serine/threonine protein kinase 26;serine/threonine protein kinase MST4;serine/threonine-protein kinase 26;serine/threonine-protein kinase MASK;STE20-like kinase 4;STE20-like kinase MST4
- Extra Details:
- The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
- Shipping Conditions:
- Blue Ice