A20960
ATP5G1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A20960
- Additional Names:
- ATP5A|ATP5G|ATP5G1
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 8kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SVVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
- Uniprot:
- P05496
- Synonyms:
- ATP synthase F(0) complex subunit C1, mitochondrial;ATP synthase lipid-binding protein;ATP synthase lipid-binding protein, mitochondrial;ATP synthase membrane subunit c locus 1;ATP synthase proteolipid P1;ATP synthase proton-transporting mitochondrial F(0) complex subunit C1;ATP synthase subunit 9;ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9);ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C1 (subunit 9);ATP synthase, H+ transporting, mitochondrial Fo complex subunit C1 (subunit 9);ATP5A;ATP5G;ATP5G1;ATPase protein 9;ATPase subunit 9;ATPase subunit C;dicyclohexylcarbodiimide (DCCD)-reactive proteolipid subunit;mitochondrial ATP synthase, subunit 9;mitochondrial ATP synthase, subunit C
- Extra Details:
- This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene is one of three genes that encode subunit c of the proton channel. Each of the three genes have distinct mitochondrial import sequences but encode the identical mature protein. Alternatively spliced transcript variants encoding the same protein have been identified.
- Shipping Conditions:
- Blue Ice