A20959
PPM1G Rabbit monoclonal antibody
Size
POA
- SKU:
- A20959
- Additional Names:
- PP2CG|PP2CGAMMA|PPM1G|PPP2CG
- Application:
- ELISA, WB
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AEEDDEEEEEEMMVPGMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQ
- Uniprot:
- O15355
- Synonyms:
- PP2C-gamma;PP2CG;PP2CGAMMA;PPP2CG;protein phosphatase 1C;protein phosphatase 1G;Protein phosphatase 2C isoform gamma;protein phosphatase magnesium-dependent 1 gamma
- Extra Details:
- The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome. Studies of a similar gene in mice suggested a role of this phosphatase in regulating cell cycle progression.
- Shipping Conditions:
- Blue Ice