A20955
Nup107 Rabbit monoclonal antibody
Size
POA
- SKU:
- A20955
- Additional Names:
- GAMOS7|NPHS11|Nup107|NUP84|ODG6
- Application:
- ELISA, WB
- Molecular Weight:
- 106 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LASKKHEAAKEVFVKIPQDSIAEIYNQCEEQGMESPLPAEDDNAIREHLCIRAYLEAHETFNEWFKHMNSVPQKPALIPQPTFTEKVAHEHKEKKYEMDFG
- Uniprot:
- P57740
- Synonyms:
- 107 kDa nucleoporin;NPHS11;nuclear pore complex protein Nup107;nucleoporin 107kDa;Nucleoporin Nup107;NUP84;ODG6;ODG6; GAMOS7
- Extra Details:
- This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is an essential component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
- Shipping Conditions:
- Blue Ice