NgR3 Rabbit monoclonal antibody

Size

POA

SKU:: A20947
Additional Names:: NgR3|NGRH2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSASSLGASLLAWTLGLAVTLR
Uniprot:: Q86UN2
Synonyms:: NgR3;NGRH2;nogo receptor-like 2;Nogo-66 receptor homolog 2;Nogo-66 receptor-related protein 3;reticulon-4 receptor-like 1
Extra Details:: Enables signaling receptor activity. Predicted to be involved in negative regulation of axon regeneration. Located in cell surface. Is anchored component of plasma membrane.