GPRC5B Rabbit monoclonal antibody

Size

POA

SKU:: A20946
Additional Names:: GPRC5B|RAIG-2|RAIG2
Application:: ELISA, WB
Molecular Weight:: 45 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPSGSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW
Uniprot:: Q9NZH0
Synonyms:: A-69G12.1;G protein-coupled receptor, family C, group 1, member B;G-protein coupled receptor family C group 5 member B;RAIG-2;RAIG2;retinoic acid responsive gene protein;retinoic acid-induced gene 2 protein
Extra Details:: This gene encodes a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The encoded protein may modulate insulin secretion and increased protein expression is associated with type 2 diabetes. Alternative splicing results in multiple transcript variants.