Glyt2 Rabbit monoclonal antibody

Size

POA

SKU:: A20931
Additional Names:: GLYT-2|GLYT2|HKPX3|NET1
Application:: ELISA, WB
Molecular Weight:: 87kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SLGQFASQGPVSVWKAIPALQGCGIAMLIISVLIAIYYNVIICYTLFYLFASFVSVLPWGSCNNPWNTPECKDKTKLLLDSCVISDHPKIQIKNSTFCMTA
Uniprot:: Q9Y345
Synonyms:: GLYT-2;GLYT2;HKPX3;NET1;sodium- and chloride-dependent glycine transporter 2;solute carrier family 6 (neurotransmitter transporter, glycine), member 5;Solute carrier family 6 member 5
Extra Details:: This gene encodes a sodium- and chloride-dependent glycine neurotransmitter transporter. This integral membrane glycoprotein is responsible for the clearance of extracellular glycine during glycine-mediated neurotransmission. This protein is found in glycinergic axons and maintains a high presynaptic pool of neurotransmitter at glycinergic synapses. Mutations in this gene cause hyperekplexia; a heterogenous neurological disorder characterized by exaggerated startle responses and neonatal apnea. Two transcript variants encoding different isoforms have been found for this gene.