RNF14 Rabbit monoclonal antibody

Size

POA

SKU:: A20913
Additional Names:: ARA54|HFB30|HRIHFB2038|RNF14|TRIAD2
Application:: ELISA, WB
Molecular Weight:: 54kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKN
Uniprot:: Q9UBS8
Synonyms:: androgen receptor associated protein 54;Androgen receptor-associated protein 54;ARA54;E3 ubiquitin-protein ligase RNF14;HFB30;HRIHFB2038;RING finger protein 14;TRIAD2;Triad2 protein
Extra Details:: The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Six alternatively spliced transcript variants encoding two distinct isoforms have been reported.