SARA Rabbit monoclonal antibody

Size

POA

SKU:: A20900
Additional Names:: MADHIP|NSP|PPP1R173|SARA|SMADIP
Application:: ELISA, WB, IHC-P
Molecular Weight:: 180kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESAVSNESQPQLKVFSLAHSAPLTTEEEDHCANGQDCNLNPEI
Uniprot:: O95405
Synonyms:: MAD, mothers against decapentaplegic homolog interacting protein, receptor activation anchor;MADH-interacting protein;MADHIP;Mothers against decapentaplegic homolog-interacting protein;novel serine protease;NSP;PPP1R173;protein phosphatase 1, regulatory subunit 173;Receptor activation anchor;SARA;smad anchor for receptor activation;SMADIP;zinc finger FYVE domain-containing protein 9;zinc finger, FYVE domain containing 9
Extra Details:: This gene encodes a double zinc finger motif-containing protein that participates in the transforming growth factor-beta (TGFB) signalling pathway. The encoded protein interacts directly with SMAD2 and SMAD3, and recruits SMAD2 to the TGFB receptor. There are multiple pseudogenes for this gene on chromosomes 2, 15, and X. Alternative splicing results in multiple transcript variants.