A20898
DENN Rabbit monoclonal antibody
Size
POA
- SKU:
- A20898
- Additional Names:
- DEEAH|DENN|IG20|NEDDISH|RAB3GEP|RabGEF
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 220kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VQDLKTGEGGLLQVTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSSEEDLRTPPRPVSS
- Uniprot:
- Q8WXG6
- Synonyms:
- DEEAH;DENN;differentially expressed in normal and neoplastic cells;IG20;insulinoma glucagonoma clone 20;MAP kinase-activating death domain protein;NEDDISH;Rab3 GDP/GTP exchange factor;rab3 GDP/GTP exchange protein;RAB3GEP;RabGEF
- Extra Details:
- Tumor necrosis factor alpha (TNF-alpha) is a signaling molecule that interacts with one of two receptors on cells targeted for apoptosis. The apoptotic signal is transduced inside these cells by cytoplasmic adaptor proteins. The protein encoded by this gene is a death domain-containing adaptor protein that interacts with the death domain of TNF-alpha receptor 1 to activate mitogen-activated protein kinase (MAPK) and propagate the apoptotic signal. It is membrane-bound and expressed at a higher level in neoplastic cells than in normal cells. Several transcript variants encoding different isoforms have been described for this gene.
- Shipping Conditions:
- Blue Ice