HINT1 Rabbit monoclonal antibody

Size

POA

SKU:: A20894
Additional Names:: HINT|HINT1|NMAN|PKCI-1|PRKCNH1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNE
Uniprot:: P49773
Synonyms:: adenosine 5'-monophosphoramidase;epididymis secretory sperm binding protein;HINT;histidine triad nucleotide-binding protein 1;NMAN;PKCI-1;PRKCNH1;protein kinase C inhibitor 1;protein kinase C-interacting protein 1
Extra Details:: This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed.