ARFRP1 / ARP Rabbit monoclonal antibody

Size

POA

SKU:: A20884
Additional Names:: ARFRP1 / ARP|ARL18|ARP|Arp1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 25kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: STDEERLAESKQAFEKVVTSEALCGVPVLVLANKQDVETCLSIPDIKTAFSDCTSKIGRRDCLTQACSALTGKGVREGIEWMVKCVVRNVHRPPRQRDIT
Uniprot:: Q13795
Synonyms:: ADP-ribosylation factor-related protein 1;ARF-related protein 1;ARL18;ARP;Arp1;epididymis secretory sperm binding protein;helicase-like protein NHL;SCG10 like-protein
Extra Details:: The protein encoded by this gene is a membrane-associated GTP-ase which localizes to the plasma membrane and is related to the ADP-ribosylation factor (ARF) and ARF-like (ARL) proteins. This gene plays a role in membrane trafficking between the trans-Golgi network and endosomes. Alternatively spliced transcript variants encoding different isoforms have been identified.