IL1RA Rabbit polyclonal antibody

Size

£152.00

SKU:: A2088
Additional Names:: DIRA|ICIL-1RA|IL-1ra|IL-1ra3|IL-1RN|IL1F3|IL1RA|IRAP|MVCD4
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Uniprot:: P18510
Synonyms:: DIRA;ICIL-1RA;IL-1ra;IL-1ra3;IL-1RN;IL1 inhibitor;IL1F3;IL1RA;interleukin-1 receptor antagonist protein;intracellular IL-1 receptor antagonist type II;intracellular interleukin-1 receptor antagonist (icIL-1ra);IRAP;MVCD4;type II interleukin-1 receptor antagonist
Extra Details:: The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Shipping Conditions:: Blue Ice