A20868
RSK2 / RPS6KA3 Rabbit monoclonal antibody
Size
POA
- SKU:
- A20868
- Additional Names:
- CLS|HU-3|ISPK-1|MAPKAPK1B|MRX19|p90-RSK2|pp90RSK2|RSK|RSK2|RSK2 / RPS6KA3|S6K-alpha3|XLID19
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 84kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK
- Uniprot:
- P51812
- Synonyms:
- 90 kDa ribosomal protein S6 kinase 3;CLS;epididymis secretory sperm binding protein;HU-3;insulin-stimulated protein kinase 1;ISPK-1;MAP kinase-activated protein kinase 1b;MAPK-activated protein kinase 1b;MAPKAP kinase 1b;MAPKAPK-1b;MAPKAPK1B;MRX19;p90-RSK 3;p90-RSK2;pp90RSK2;ribosomal protein S6 kinase alpha-3;ribosomal protein S6 kinase, 90kDa, polypeptide 3;ribosomal S6 kinase 2;RSK;RSK-2;RSK2;S6K-alpha-3;S6K-alpha3;XLID19
- Extra Details:
- This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS).
- Shipping Conditions:
- Blue Ice