A20866
Lactate Dehydrogenase C Rabbit monoclonal antibody
Size
POA
- SKU:
- A20866
- Additional Names:
- CT32|Lactate Dehydrogenase C|LDH3|LDHX
- Application:
- ELISA, WB
- Molecular Weight:
- 36 kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQ
- Uniprot:
- P07864
- Synonyms:
- cancer/testis antigen 32;CT32;L-lactate dehydrogenase C chain;lactate dehydrogenase c variant 1;lactate dehydrogenase c variant 3;lactate dehydrogenase c variant 4;lactate dehydrogenase c variant 5;lactate dehydrogenase C4;LDH testis subunit;LDH-C;LDH-X;LDH3;LDHX;testis secretory sperm-binding protein Li 234P
- Extra Details:
- Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.
- Shipping Conditions:
- Blue Ice