Bag1 Rabbit monoclonal antibody

Size

POA

SKU:: A20863
Additional Names:: BAG-1|Bag1|HAP|RAP46
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 33kDa/46kDa/52kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: WSEEATQSEEATQGEEMNRSQEVTRDEESTRSEEVTREEMAAAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEM
Uniprot:: Q99933
Synonyms:: BAG family molecular chaperone regulator 1;BAG-1;Bcl-2 associating athanogene-1 protein;Bcl-2-associated athanogene 1;Bcl-2-binding protein;BCL2 associated athanogene 1;BCL2-associated athanogene;glucocortoid receptor-associated protein RAP46;HAP;RAP46;receptor-associated protein, 46-KD
Extra Details:: The oncogene BCL2 is a membrane protein that blocks a step in a pathway leading to apoptosis or programmed cell death. The protein encoded by this gene binds to BCL2 and is referred to as BCL2-associated athanogene. It enhances the anti-apoptotic effects of BCL2 and represents a link between growth factor receptors and anti-apoptotic mechanisms. Multiple protein isoforms are encoded by this mRNA through the use of a non-AUG (CUG) initiation codon, and three alternative downstream AUG initiation codons. A related pseudogene has been defined on chromosome X.