A2085
HNF4A Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2085
- Additional Names:
- FRTS4|HNF4|HNF4A|HNF4a7|HNF4a8|HNF4a9|HNF4alpha|MODY|MODY1|NR2A1|NR2A21|TCF|TCF-14|TCF14
- Application:
- ELISA, WB
- Molecular Weight:
- 52kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYIND
- Uniprot:
- P41235
- Synonyms:
- FRTS4;hepatic nuclear factor 4 alpha;hepatocyte nuclear factor 4-alpha;HNF4;HNF4a7;HNF4a8;HNF4a9;HNF4alpha;HNF4alpha10/11/12;MODY;MODY1;NR2A1;NR2A21;nuclear receptor subfamily 2 group A member 1;TCF;TCF-14;TCF14;transcription factor 14;transcription factor HNF-4
- Extra Details:
- The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
- Shipping Conditions:
- Blue Ice



