Prdm9 Rabbit monoclonal antibody

Size

POA

SKU:: A20832
Additional Names:: Dsbc1|G1-419-29|Meisetz|Prdm9|PRDM9-B|Rcr1|repro7
Application:: ELISA, IHC-P, FuncS
Molecular Weight:: Refer to figures
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DSEDSDEEWTPKQQVSPPWVPFRVKHSKQQKESSRMPFSGESNVKEGSGIENLLNTSGSEHVQKPVSSLEEGNTSGQHSGKKLKLRKKNVEVKMYRLRERKGLAYEEVSEPQDDDYLYCEKCQNFFIDSCPNHGPPLFVKDSMVDRGHPNHSVLSLPPGLRISPSGIPEAGLGVWNEASDLPVGLHFGPYEGQITEDEEAANSGYSWLITKGRNCYEYVDGQDESQANWMRYVNCARDDEEQNLVAFQYHRKIFYRTCRVIRPGCELLVWYGDEYGQELGIKWG
Uniprot:: Q96EQ9
Synonyms:: [histone H3]-lysine36 N-trimethyltransferase PRDM9;[histone H3]-lysine4 N-trimethyltransferase PRDM9;[histone H3]-lysine9 N-trimethyltransferase PRDM9;[histone H4]-lysine20 N-methyltransferase PRDM9;[histone H4]-N-methyl-L-lysine20 N-methyltransferase PRDM9;BC012016;Dsbc;Dsbc1;G1-419-29;histone H3 lysine-4 methyltransferase;histone methyl transferase;histone-lysine N-methyltransferase PRDM9;hybrid sterility protein 1;KMT8B;meiosis-induced factor containing a PR/SET domain and zinc-finger motif;Meise;MEISETZ;minisatellite binding protein 3 (115kD);MSBP3;PFM6;PR domain 9;PR domain containing 9;PR domain zinc finger protein 9;PR domain-containing protein 9;PRDM9-B;protein-lysine N-methyltransferase PRDM9;Rc;Rcr1;re;repro7;VPR domain containing 9;ZNF899
Extra Details:: Enables DNA binding activity; histone-lysine N-methyltransferase activity; and protein homodimerization activity. Involved in several processes, including gamete generation; histone lysine methylation; and meiosis I. Acts upstream of or within several processes, including histone methylation; positive regulation of meiotic nuclear division; and positive regulation of transcription by RNA polymerase II. Located in chromatin and nucleus. Is expressed in embryo and head. Orthologous to human PRDM9 (PR/SET domain 9).

Shipping Conditions:: Blue Ice