Timm22 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20813
Additional Names:: Tim22|Timm22
Application:: ELISA, WB, IP
Molecular Weight:: 20kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIERAMESCAFKAVLACVGGFVLGGAFGIFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQR
Uniprot:: Q9CQ85
Synonyms:: mitochondrial import inner membrane translocase subunit Tim22;preprotein translocase;Tim22;translocase of inner mitochondrial membrane 22 homolog
Extra Details:: Predicted to enable mitochondrion targeting sequence binding activity and protein transmembrane transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; cardiovascular system; egg cylinder; and genitourinary system. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 43. Orthologous to human TIMM22 (translocase of inner mitochondrial membrane 22).