Timm29 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20812
Additional Names:: 1810026J23Rik|TIM29|Timm29
Application:: ELISA, WB, IP
Molecular Weight:: 29kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: YLQPRWVDFPGRILDVGFVGRWWILQNRMHDCDINDDEFLHLPAHLRVVAPHQLHSEANERLFEEKYKPIILTDDQVDQALWEEQVLQKERKDRLALSEADSLVQSDVSR
Uniprot:: Q8BGX2
Synonyms:: 1810026J23Rik;mitochondrial import inner membrane translocase subunit Tim29;TIM29;uncharacterized protein C19orf52 homolog
Extra Details:: Predicted to enable protein transporter activity. Predicted to be involved in protein insertion into mitochondrial inner membrane. Predicted to act upstream of or within protein transport. Predicted to be located in mitochondrial inner membrane and mitochondrial intermembrane space. Predicted to be part of TIM22 mitochondrial import inner membrane insertion complex. Orthologous to human TIMM29 (translocase of inner mitochondrial membrane 29).