A20810
RBFOX2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20810
- Additional Names:
- dJ106I20.3|Fox-2|FOX2|fxh|HNRBP2|HRNBP2|RBFOX2|RBM9|RTA
- Application:
- ELISA, WB
- Molecular Weight:
- 50kDa/60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTTEGGAQTDGQQSQTQSSENSESKSTP
- Uniprot:
- O43251
- Synonyms:
- dJ106I20.3;fox-1 homolog B;fox-1 homologue;Fox-2;FOX2;fxh;hexaribonucleotide-binding protein 2;HNRBP2;HRNBP2;RBM9;repressor of tamoxifen transcriptional activity;RNA binding protein fox-1 homolog 2;RNA binding protein, fox-1 homolog 2;RNA-binding motif protein 9;RNA-binding protein 9;RTA
- Extra Details:
- This gene is one of several human genes similar to the C. elegans gene Fox-1. This gene encodes an RNA binding protein that is thought to be a key regulator of alternative exon splicing in the nervous system and other cell types. The protein binds to a conserved UGCAUG element found downstream of many alternatively spliced exons and promotes inclusion of the alternative exon in mature transcripts. The protein also interacts with the estrogen receptor 1 transcription factor and regulates estrogen receptor 1 transcriptional activity. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice