A20725
PIF4 Rabbit polyclonal antibody
Size
POA
- SKU:
- A20725
- Additional Names:
- AtPIF4|MFL8_13|MFL8.13|phytochrome interacting factor 4|PIF4|SRL2
- Application:
- ELISA, WB
- Molecular Weight:
- 55kDa
- Species Reactivity:
- Plant
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Plant
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IDYLKSLQLQLQVMWMGSGMAAAAASAPMMFPGVQPQQFIRQIQSPVQLPRFPVMDQSAIQNNPGLVCQNPVQNQIISDRFARYIGGFPHMQAATQMQPME
- Uniprot:
- Q8W2F3
- Synonyms:
- AT2G43010;AtPIF4;Basic helix-loop-helix protein 9;bHLH transcription factor bHLH009;MFL8_13;MFL8.13;phytochrome interacting factor 4;Phytochrome-interacting factor 4;Short under red-light 2;SRL2;Transcription factor EN 102
- Extra Details:
- Isolated as a semidominant mutation defective in red -light responses. Encodes a nuclear localized bHLH protein that interacts with active PhyB protein. Negatively regulates phyB mediated red light responses. Involved in shade avoidance response. Protein abundance is negatively regulated by PhyB.
- Shipping Conditions:
- Blue Ice