IKKA Alpha Rabbit polyclonal antibody

Size

£152.00

SKU:: A2062
Additional Names:: BPS2|IKBKA|IKK-alpha|IKK1|IKKA|IKKA Alpha|NFKBIKA|TCF16
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 85kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTP
Uniprot:: O15111
Synonyms:: BPS2;conserved helix-loop-helix ubiquitous kinase;I-kappa-B kinase 1;I-kappa-B kinase-alpha;IkB kinase alpha subunit;IKBKA;IKK-a kinase;IKK-alpha;IKK1;IKKA;inhibitor of nuclear factor kappa-B kinase subunit alpha;NFKBIKA;Nuclear factor NF-kappa-B inhibitor kinase alpha;Nuclear factor NFkappaB inhibitor kinase alpha;TCF-16;TCF16;transcription factor 16
Extra Details:: This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor.