A20612
HCoV-HKU1 Nucleoprotein Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20612
- Application:
- ELISA, WB
- Molecular Weight:
- 50-60kDa
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- WYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPG
- Uniprot:
- Q5MQC6
- Synonyms:
- HCHV1gp7;nucleocapsid phosphoprotein;Nucleocapsid protein
- Extra Details:
- Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
- Shipping Conditions:
- Blue Ice