INTS6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20602
Additional Names:: DBI-1|DDX26|DDX26A|DICE1|HDB|INT6|INTS6|Notchl2
Application:: ELISA, WB
Molecular Weight:: 117kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HKISETTNDSIIHDVVENHVADQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQTRLIFLQNVIKEASRFKKRMLIEQLENFLDEIHRRANQINHINSN
Uniprot:: Q9UL03
Synonyms:: DBI-1;DDX26;DDX26A;DEAD box protein;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 26;DICE1;HDB;INT6;integrator complex subunit 6;Notchl2;Protein DDX26;protein deleted in cancer 1;RNA helicase HDB
Extra Details:: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and is located in the critical region of loss of heterozygosity (LOH). Multiple transcript variants encoding different isoforms have been found for this gene.