PRRX2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20558
Additional Names:: PMX2|PRRX2|PRX2
Application:: ELISA, WB
Molecular Weight:: 27kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: QEAAIEQPVAPRPTALSPDYLSWTASSPYSTVPPYSPGSSGPATPGVNMANSIASLRLKAKEFSLHHSQVPTVN
Uniprot:: Q99811
Synonyms:: paired mesoderm homeobox protein 2;paired-like homeodomain protein PRX2;paired-related homeobox protein 2;PMX2;PRX-2;PRX2;testicular tissue protein Li 148;testicular tissue protein Li 160
Extra Details:: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins. Expression is localized to proliferating fetal fibroblasts and the developing dermal layer, with downregulated expression in adult skin. Increases in expression of this gene during fetal but not adult wound healing suggest a possible role in mechanisms that control mammalian dermal regeneration and prevent formation of scar response to wounding. The expression patterns provide evidence consistent with a role in fetal skin development and a possible role in cellular proliferation.