SARM1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20556
Additional Names:: hSARM1|HsTIR|MyD88-5|SAMD2|SARM|SARM1
Application:: ELISA, WB, IP
Molecular Weight:: 73kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRSSRDSSAGSDTSLEGAAPMGPT
Uniprot:: Q6SZW1
Synonyms:: hSARM1;HsTIR;MyD88-5;NAD(+) hydrolase SARM1;NADase SARM1;NADP(+) hydrolase SARM1;SAM domain-containing protein 2;SAMD2;SARM;sterile alpha and Armadillo repeat protein;sterile alpha and HEAT/Armadillo motif protein, ortholog of Drosophila;sterile alpha and TIR motif-containing protein 1;sterile alpha motif domain-containing protein 2;tir-1 homolog
Extra Details:: Enables NAD+ nucleotidase, cyclic ADP-ribose generating and identical protein binding activity. Involved in NAD catabolic process; positive regulation of neuron death; and response to axon injury. Located in mitochondrion.