A2055
RUNX1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A2055
- Additional Names:
- AML1|AML1-EVI-1|AMLCR1|CBF2alpha|CBFA2|EVI-1|PEBP2aB|PEBP2alpha|RUNX1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 55 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQY
- Uniprot:
- Q01196
- Synonyms:
- acute myeloid leukemia 1 protein;AML1;AML1-ETO fusion;AML1-ETO fusion protein;AML1-EVI-1;AML1-EVI-1 fusion protein;AMLCR1;CBF2alpha;CBFA2;Core-binding factor subunit alpha-2;core-binding factor, runt domain, alpha subunit 2;EVI-1;mutant RUNX1;oncogene AML-1;PEA2-alpha B;PEBP2-alpha B;PEBP2aB;PEBP2alpha;polyomavirus enhancer-binding protein 2 alpha B subunit;runt related transcription factor 1;runt-related transcription factor 1;SL3-3 enhancer factor 1 alpha B subunit;SL3/AKV core-binding factor alpha B subunit
- Extra Details:
- Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice








