A20547
CD96 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20547
- Additional Names:
- CD96|TACTILE
- Application:
- ELISA, WB
- Molecular Weight:
- 100-200kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EIPVIVENNSTDVLVERRFTCLLKNVFPKANITWFIDGSFLHDEKEGIYITNEERKGKDGFLELKSVLTRVHSNKPAQSDNLTIWCMALSPVPGNKVWNIS
- Uniprot:
- P40200
- Synonyms:
- cell surface antigen CD96;T cell activation, increased late expression;t cell-activated increased late expression protein;T-cell surface protein tactile;TACTILE
- Extra Details:
- The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein. The protein may play a role in the adhesive interactions of activated T and NK cells during the late phase of the immune response. It may also function in antigen presentation. Alternative splicing generates multiple transcript variants encoding distinct isoforms.
- Shipping Conditions:
- Blue Ice