A20500
MED26 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A20500
- Additional Names:
- CRSP7|CRSP70|MED26
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWY
- Uniprot:
- O95402
- Synonyms:
- activator-recruited cofactor 70 kDa component;ARC70;cofactor required for Sp1 transcriptional activation subunit 7;cofactor required for Sp1 transcriptional activation, subunit 7 (70kD);cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa;CRSP complex subunit 7;CRSP7;CRSP70;Mediator complex subunit 26;mediator of RNA polymerase II transcription subunit 26;transcriptional coactivator CRSP70
- Extra Details:
- The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
- Shipping Conditions:
- Blue Ice