DTX1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A20499
Additional Names:: DTX1|hDx-1|RNF140
Application:: ELISA, WB
Molecular Weight:: 67-72kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSW
Uniprot:: Q86Y01
Synonyms:: deltex 1, E3 ubiquitin ligase;deltex homolog 1;E3 ubiquitin-protein ligase DTX1;hDx-1;protein deltex-1;RING-type E3 ubiquitin transferase DTX1;RNF140
Extra Details:: Studies in Drosophila have identified this gene as encoding a positive regulator of the Notch-signaling pathway. The human gene encodes a protein of unknown function; however, it may play a role in basic helix-loop-helix transcription factor activity.